(data stored in ACNUC9435 zone)

EMBL: CP002400.PE448

CP002400.PE448       Location/Qualifiers
FT   CDS             complement(491095..491586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0454"
FT                   /product="Uncharacterized protein family UPF0547"
FT                   /note="PFAM: Uncharacterised protein family UPF0547; KEGG:
FT                   cai:Caci_4437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26039"
FT                   /db_xref="GOA:E6U8X5"
FT                   /db_xref="InterPro:IPR018886"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X5"
FT                   /inference="protein motif:PFAM:PF10571"
FT                   /protein_id="ADU26039.1"
FT                   /translation="MKNCPQCHHDCADDMIICPDCGYLFSATQPPNDWQQNPPYQSAQN
FT                   GGQPFGNGYNGYPPYQNVPKDSLATPSMVLGIIGVVASCCFIGVIPAIIGLIFGIISKL
FT                   RIARTGARGSGLALAGIILSSVAIAITIVVLIRVIIVFNDPAAMEQYRRIIEQYQQAQQ
FT                   "
     MKNCPQCHHD CADDMIICPD CGYLFSATQP PNDWQQNPPY QSAQNGGQPF GNGYNGYPPY        60
     QNVPKDSLAT PSMVLGIIGV VASCCFIGVI PAIIGLIFGI ISKLRIARTG ARGSGLALAG       120
     IILSSVAIAI TIVVLIRVII VFNDPAAMEQ YRRIIEQYQQ AQQ                         163
//

If you have problems or comments...

PBIL Back to PBIL home page