(data stored in ACNUC9435 zone)

EMBL: CP002400.PE45

CP002400.PE45        Location/Qualifiers
FT   CDS             51152..51961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0045"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ote:Oter_2169 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25636"
FT                   /db_xref="GOA:E6U5G9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G9"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADU25636.1"
FT                   /translation="MPTAALGCDTVFEHHQAAIEAATKELSTWDEVLGVIIYGSVAHGF
FT                   ALENSDVDIKIVCTDDFFTAKEHMGNVSYFDRDATPYEGGYVDGEFITPMHIERIAADG
FT                   SESARFDFQDAIVTFDRQGGLEDLVRGAARYPVEQKRRKMVRFYAQFSAWKAHYYEALR
FT                   RDNHYLAHLSALQFALYAGRLFLAYNETLFPGHKWFLQVLSGVPQKPAGLMRCLNTLVD
FT                   QKRAEDVERLYNMVSDFACWPHDSSQDRQFLWDVRMGRIEDFPFAAD"
     MPTAALGCDT VFEHHQAAIE AATKELSTWD EVLGVIIYGS VAHGFALENS DVDIKIVCTD        60
     DFFTAKEHMG NVSYFDRDAT PYEGGYVDGE FITPMHIERI AADGSESARF DFQDAIVTFD       120
     RQGGLEDLVR GAARYPVEQK RRKMVRFYAQ FSAWKAHYYE ALRRDNHYLA HLSALQFALY       180
     AGRLFLAYNE TLFPGHKWFL QVLSGVPQKP AGLMRCLNTL VDQKRAEDVE RLYNMVSDFA       240
     CWPHDSSQDR QFLWDVRMGR IEDFPFAAD                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page