(data stored in ACNUC9435 zone)

EMBL: CP002400.PE450

CP002400.PE450       Location/Qualifiers
FT   CDS             492362..493747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0456"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   hmo:HM1_1957 fad dependent oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26041"
FT                   /db_xref="GOA:E6U8X7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADU26041.1"
FT                   /translation="MLKTHYDIVIIGGGIGGLMCAWRLAEKCPDASVAIFEKGEDINNR
FT                   RCPIVSGQAKSCMRCKSCAIMEGLAGAGAFSDGKYIISHEYGGWLPEFLPGQTVVDYIE
FT                   QADRILVSCGATTERFQPDDALKKLCLAHDLHMQQAVVKHLGTDANLETMRRMVDQLRG
FT                   KCAIFTHAEVTDVQADSRTLVVRLPDGEHTCTAENIVFAVGRAGSGFFSAWCARNHVEL
FT                   HNNQVDVGVRVELPAIVWEDFSKKIYEPKIWYRSKNYGDVTRMFCFNERGQVVTENTGG
FT                   ILTVNGHAYRDPAKKTENSNFALLATMRFTSPFREPIAYAKHVASLANLISGGSVLVQR
FT                   LGDLEQGRRTDEKRLHDSTTRPTLRAVAGDLSLCMPKRQLDDIIETLHALDVIAPGTAN
FT                   HDTLLYGVECKYYSARPETEDFELKGYSHIYAIGDGAGFTRSLAQASANGLYLADKLAR
FT                   GRI"
     MLKTHYDIVI IGGGIGGLMC AWRLAEKCPD ASVAIFEKGE DINNRRCPIV SGQAKSCMRC        60
     KSCAIMEGLA GAGAFSDGKY IISHEYGGWL PEFLPGQTVV DYIEQADRIL VSCGATTERF       120
     QPDDALKKLC LAHDLHMQQA VVKHLGTDAN LETMRRMVDQ LRGKCAIFTH AEVTDVQADS       180
     RTLVVRLPDG EHTCTAENIV FAVGRAGSGF FSAWCARNHV ELHNNQVDVG VRVELPAIVW       240
     EDFSKKIYEP KIWYRSKNYG DVTRMFCFNE RGQVVTENTG GILTVNGHAY RDPAKKTENS       300
     NFALLATMRF TSPFREPIAY AKHVASLANL ISGGSVLVQR LGDLEQGRRT DEKRLHDSTT       360
     RPTLRAVAGD LSLCMPKRQL DDIIETLHAL DVIAPGTANH DTLLYGVECK YYSARPETED       420
     FELKGYSHIY AIGDGAGFTR SLAQASANGL YLADKLARGR I                           461
//

If you have problems or comments...

PBIL Back to PBIL home page