(data stored in ACNUC9435 zone)

EMBL: CP002400.PE451

CP002400.PE451       Location/Qualifiers
FT   CDS             493784..494872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0457"
FT                   /product="Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: gtn:GTNG_0194
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; PFAM: glycosyl
FT                   transferase family 28; Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26042"
FT                   /db_xref="GOA:E6U8X8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X8"
FT                   /inference="protein motif:PRIAM:2.4.1.227"
FT                   /protein_id="ADU26042.1"
FT                   /translation="MKKIVLTGGGTAGHITPNLALLPLLQTAGFSISYIGLKDGMEEGL
FT                   IRPTGVAFYGITGGKLRRYADLKNFTDLFRIGAGFWESVSLLRKLKPDVLFSKGGFVST
FT                   PVVWAAKLCGVPVVTHESDSTFGLANRLSAPFARKMCYTFPESGAHLPEDKGVFTGLPI
FT                   REQLLHGNREKGLRLCEFSADKPVLVVTGGSQGAAFINRMVRRCLPKLLETFQVCHLCG
FT                   KGNVDEKLEGMPGYRQFAYVTDDLPDVFAMADMVVTRGGSTSLFELLALQKPMLIIPYS
FT                   RKASRGDQIINGRSFQKQGFGEVLMEADENGMDMMPAAFLRAVRQVYENRERYIENMQK
FT                   SPARGGAQNVFAVLCEVAGLSS"
     MKKIVLTGGG TAGHITPNLA LLPLLQTAGF SISYIGLKDG MEEGLIRPTG VAFYGITGGK        60
     LRRYADLKNF TDLFRIGAGF WESVSLLRKL KPDVLFSKGG FVSTPVVWAA KLCGVPVVTH       120
     ESDSTFGLAN RLSAPFARKM CYTFPESGAH LPEDKGVFTG LPIREQLLHG NREKGLRLCE       180
     FSADKPVLVV TGGSQGAAFI NRMVRRCLPK LLETFQVCHL CGKGNVDEKL EGMPGYRQFA       240
     YVTDDLPDVF AMADMVVTRG GSTSLFELLA LQKPMLIIPY SRKASRGDQI INGRSFQKQG       300
     FGEVLMEADE NGMDMMPAAF LRAVRQVYEN RERYIENMQK SPARGGAQNV FAVLCEVAGL       360
     SS                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page