(data stored in ACNUC9435 zone)

EMBL: CP002400.PE452

CP002400.PE452       Location/Qualifiers
FT   CDS             complement(494927..495403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0458"
FT                   /product="iron dependent repressor"
FT                   /note="KEGG: clj:CLJU_c34350 putative metal dependent
FT                   transcriptional regulator; PFAM: iron dependent repressor;
FT                   SMART: iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26043"
FT                   /db_xref="GOA:E6U8X9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X9"
FT                   /inference="protein motif:PFAM:PF01325"
FT                   /protein_id="ADU26043.1"
FT                   /translation="MQNDRFYTFHEYLKTEDGALSASMEDYLEMIWRLSGPNGFTRIHE
FT                   LSQALHIRQSSATKMVQRLAQKGYVRYQKYGFLTLEEKGKQAGAWLMQRHRAIERFMRM
FT                   IAVPEALVLEETEKTEHMFGVESTLCLEHFVRFLSARPEVIEQYRLAFPNTGAT"
     MQNDRFYTFH EYLKTEDGAL SASMEDYLEM IWRLSGPNGF TRIHELSQAL HIRQSSATKM        60
     VQRLAQKGYV RYQKYGFLTL EEKGKQAGAW LMQRHRAIER FMRMIAVPEA LVLEETEKTE       120
     HMFGVESTLC LEHFVRFLSA RPEVIEQYRL AFPNTGAT                               158
//

If you have problems or comments...

PBIL Back to PBIL home page