(data stored in ACNUC9435 zone)

EMBL: CP002400.PE468

CP002400.PE468       Location/Qualifiers
FT   CDS             509926..510462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0474"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: clo:HMPREF0868_0491 type I
FT                   restriction modification DNA specificity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26059"
FT                   /db_xref="GOA:E6U8Z5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z5"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADU26059.1"
FT                   /translation="MDQWKLVRAMDFIDFNPRESITKGVVAKKVAMEHLLPFTRDVSSY
FT                   EFSPFHGGSKFRNGDTLMARITPCLENGKTALVNILDQGEVGFGSTEFIVMRARPGISD
FT                   KDFIYYLAQSPILRDKAIKSMVGSSGRQRVQLSVLNDTKFYAPPLEEQIEIAGILRALD
FT                   DKIANNTAINHHLAA"
     MDQWKLVRAM DFIDFNPRES ITKGVVAKKV AMEHLLPFTR DVSSYEFSPF HGGSKFRNGD        60
     TLMARITPCL ENGKTALVNI LDQGEVGFGS TEFIVMRARP GISDKDFIYY LAQSPILRDK       120
     AIKSMVGSSG RQRVQLSVLN DTKFYAPPLE EQIEIAGILR ALDDKIANNT AINHHLAA         178
//

If you have problems or comments...

PBIL Back to PBIL home page