(data stored in ACNUC9435 zone)

EMBL: CP002400.PE476

CP002400.PE476       Location/Qualifiers
FT   CDS             complement(518180..518908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_2328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26067"
FT                   /db_xref="UniProtKB/TrEMBL:E6U903"
FT                   /inference="similar to AA sequence:KEGG:CKR_2328"
FT                   /protein_id="ADU26067.1"
FT                   /translation="MANRTQFFSDGTTVYGASDFIAPMNALTTSGIIGGYQVTAPSSGM
FT                   TVNVAAGSAILNGVLTTDDTTQAVPVPTNTGGNARTDAIVLQIDATAMTTTVVDVPGAT
FT                   TEAANQILLAVVTVPAGASSIVAGNIDGSGRVYAGLDNPFAAVASASLGSNGYVLLGNG
FT                   LALQWGTLSLGAFPAYTDVSFPQAFSAVPFTIVATMEDSAPSAVSTAVWTAAKFTVIQA
FT                   DSVAHLMHWFAIGPMAVTRM"
     MANRTQFFSD GTTVYGASDF IAPMNALTTS GIIGGYQVTA PSSGMTVNVA AGSAILNGVL        60
     TTDDTTQAVP VPTNTGGNAR TDAIVLQIDA TAMTTTVVDV PGATTEAANQ ILLAVVTVPA       120
     GASSIVAGNI DGSGRVYAGL DNPFAAVASA SLGSNGYVLL GNGLALQWGT LSLGAFPAYT       180
     DVSFPQAFSA VPFTIVATME DSAPSAVSTA VWTAAKFTVI QADSVAHLMH WFAIGPMAVT       240
     RM                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page