(data stored in ACNUC9435 zone)

EMBL: CP002400.PE482

CP002400.PE482       Location/Qualifiers
FT   CDS             525969..526505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dth:DICTH_1150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26073"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:E6U909"
FT                   /inference="similar to AA sequence:KEGG:DICTH_1150"
FT                   /protein_id="ADU26073.1"
FT                   /translation="MADDLMDQLPDNVAREIPNTEKIELCLKGTNKEWLVCTTAKLYII
FT                   KKGFMTGHTFGSGIYQMPYKNITGVQTEYHALSGYFQVSTGGMADKPKDYWGKGADRPQ
FT                   ESPNCVTITGKTLLARFRAGCDFINNKIADAHAPVTAAQVPSAADELKKFADLHAQGIL
FT                   TDEEFTAKKKQLLGI"
     MADDLMDQLP DNVAREIPNT EKIELCLKGT NKEWLVCTTA KLYIIKKGFM TGHTFGSGIY        60
     QMPYKNITGV QTEYHALSGY FQVSTGGMAD KPKDYWGKGA DRPQESPNCV TITGKTLLAR       120
     FRAGCDFINN KIADAHAPVT AAQVPSAADE LKKFADLHAQ GILTDEEFTA KKKQLLGI         178
//

If you have problems or comments...

PBIL Back to PBIL home page