(data stored in ACNUC9435 zone)

EMBL: CP002400.PE485

CP002400.PE485       Location/Qualifiers
FT   CDS             complement(527504..528007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmg:Nmag_1329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26076"
FT                   /db_xref="UniProtKB/TrEMBL:E6U912"
FT                   /inference="similar to AA sequence:KEGG:Nmag_1329"
FT                   /protein_id="ADU26076.1"
FT                   /translation="MKLSELMQGKTPSATYAGFATNDDFVLAVDTGDGTTSTADADYAV
FT                   VEAGVTKSEASADAETKDNQYIRTGKKTTKTGTQRKFSIEGDRCDGDAFQDFCLSNAIV
FT                   FGVGAAVERKYIYFNMLTGVGERGTVTIVVSDTQTGDAGDNATFKVDMTSTSTPTNYTY
FT                   SSGS"
     MKLSELMQGK TPSATYAGFA TNDDFVLAVD TGDGTTSTAD ADYAVVEAGV TKSEASADAE        60
     TKDNQYIRTG KKTTKTGTQR KFSIEGDRCD GDAFQDFCLS NAIVFGVGAA VERKYIYFNM       120
     LTGVGERGTV TIVVSDTQTG DAGDNATFKV DMTSTSTPTN YTYSSGS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page