(data stored in ACNUC9435 zone)

EMBL: CP002400.PE486

CP002400.PE486       Location/Qualifiers
FT   CDS             complement(528010..528429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26077"
FT                   /db_xref="UniProtKB/TrEMBL:E6U913"
FT                   /inference="similar to AA sequence:KEGG:CLK_1328"
FT                   /protein_id="ADU26077.1"
FT                   /translation="MSIINSLYEYFKSCPLLGDNKINVDYLPETAREYTIDTITGDPII
FT                   KRYARGATLRQYLYAFGSRDFYGPDVLQNLSNSGFYGDFAAWLDEQNKAKNFPVLPPNC
FT                   VPQKIEAQTSGYLFGADAETARYQIQCRIVYYQEG"
     MSIINSLYEY FKSCPLLGDN KINVDYLPET AREYTIDTIT GDPIIKRYAR GATLRQYLYA        60
     FGSRDFYGPD VLQNLSNSGF YGDFAAWLDE QNKAKNFPVL PPNCVPQKIE AQTSGYLFGA       120
     DAETARYQIQ CRIVYYQEG                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page