(data stored in ACNUC9435 zone)

EMBL: CP002400.PE490

CP002400.PE490       Location/Qualifiers
FT   CDS             complement(529644..530819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jde:Jden_2169 major capsid protein HK97"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26081"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:E6U917"
FT                   /inference="similar to AA sequence:KEGG:Jden_2169"
FT                   /protein_id="ADU26081.1"
FT                   /translation="MPIDRQAAQALIQDQIVNTIFEDVPKQSSTLSLMRKLPNMTSKQT
FT                   RIPVLDTLPLAYWVNGDTGYKQTTRQAWENVWLTAAEMAAIVPIPEAVLDDSSYDIMGE
FT                   VQPRVNEAMGAVIDGAIAFGVGRPSEWQNDIITLARQAGNNVSASGGITYDNIMGQDGL
FT                   ISKVEESGYMVDGILASIKTRAGLRGIKDSNNRPIFVPDMQSGTTYTLDGTPITFQQNG
FT                   AFNATVAQMIAGAWSQAVYAMRQDVTVKILDQGVIQDPNTKEIIYNLAQQDMIALRVVM
FT                   RLGWALPNPATAVNSDRTNVPFAYIEAATPYTDYSVTFTVKDNATDPIAGVRVNVNGAN
FT                   KKTAADGTAVFNLRAGTYPATIKADGYVPQTATVTVTNAPVPVAITLQAAS"
     MPIDRQAAQA LIQDQIVNTI FEDVPKQSST LSLMRKLPNM TSKQTRIPVL DTLPLAYWVN        60
     GDTGYKQTTR QAWENVWLTA AEMAAIVPIP EAVLDDSSYD IMGEVQPRVN EAMGAVIDGA       120
     IAFGVGRPSE WQNDIITLAR QAGNNVSASG GITYDNIMGQ DGLISKVEES GYMVDGILAS       180
     IKTRAGLRGI KDSNNRPIFV PDMQSGTTYT LDGTPITFQQ NGAFNATVAQ MIAGAWSQAV       240
     YAMRQDVTVK ILDQGVIQDP NTKEIIYNLA QQDMIALRVV MRLGWALPNP ATAVNSDRTN       300
     VPFAYIEAAT PYTDYSVTFT VKDNATDPIA GVRVNVNGAN KKTAADGTAV FNLRAGTYPA       360
     TIKADGYVPQ TATVTVTNAP VPVAITLQAA S                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page