(data stored in ACNUC9435 zone)

EMBL: CP002400.PE507

CP002400.PE507       Location/Qualifiers
FT   CDS             complement(541576..541863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nve:NEMVE_v1g211222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26098"
FT                   /db_xref="InterPro:IPR024522"
FT                   /db_xref="UniProtKB/TrEMBL:E6U934"
FT                   /inference="similar to AA sequence:KEGG:NEMVE_v1g211222"
FT                   /protein_id="ADU26098.1"
FT                   /translation="MGLFILGSFFGASAGVTVMCLLQIGKRKGDETLGLWYLSAVESAV
FT                   FLEQLHQADTRDLRIAKAALGSYKAQGYHVADRYQAVKKELNKRMAYGRR"
     MGLFILGSFF GASAGVTVMC LLQIGKRKGD ETLGLWYLSA VESAVFLEQL HQADTRDLRI        60
     AKAALGSYKA QGYHVADRYQ AVKKELNKRM AYGRR                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page