(data stored in ACNUC9435 zone)

EMBL: CP002400.PE522

CP002400.PE522       Location/Qualifiers
FT   CDS             complement(557523..557798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0533"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="manually curated; TIGRFAM: addiction module toxin,
FT                   RelE/StbE family; KEGG: clo:HMPREF0868_1572 toxin-antitoxin
FT                   system, toxin component, RelE family; PFAM: plasmid
FT                   stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26113"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9C2"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ADU26113.1"
FT                   /translation="MDIVWTTQFKKDYKLAMKRGLKMDLLDNIIRQLSKGQLLPEKNRD
FT                   HLLTGNWVGYRECHIQSDWLLVYRIENGVLVLTLSRTGSHSDLFGE"
     MDIVWTTQFK KDYKLAMKRG LKMDLLDNII RQLSKGQLLP EKNRDHLLTG NWVGYRECHI        60
     QSDWLLVYRI ENGVLVLTLS RTGSHSDLFG E                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page