(data stored in ACNUC9435 zone)

EMBL: CP002400.PE532

CP002400.PE532       Location/Qualifiers
FT   CDS             complement(564656..565375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0545"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   kfl:Kfla_1474 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26123"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU26123.1"
FT                   /translation="MSGQLNKQKVLVIGGSKYLGLAIAKQASEAGAEVVIGARNPEQAS
FT                   QAAAQLPLASAIRVDITDEGTIAAAASQLGHVDHVVITASAHHNVRVQDLEHDKIVTAF
FT                   EAKVIGPLLLAKHFAPIISPAGSILLFSGVAAWKPSPEYTVMGVTNGAVAFLVSQLAKE
FT                   LAPIRVNAISPGITDSGTWNVLGKQNKRELLESASVSSLVGRAGTADDIADAAIWLLGA
FT                   GFVSGETIHVEGGTRHT"
     MSGQLNKQKV LVIGGSKYLG LAIAKQASEA GAEVVIGARN PEQASQAAAQ LPLASAIRVD        60
     ITDEGTIAAA ASQLGHVDHV VITASAHHNV RVQDLEHDKI VTAFEAKVIG PLLLAKHFAP       120
     IISPAGSILL FSGVAAWKPS PEYTVMGVTN GAVAFLVSQL AKELAPIRVN AISPGITDSG       180
     TWNVLGKQNK RELLESASVS SLVGRAGTAD DIADAAIWLL GAGFVSGETI HVEGGTRHT        239
//

If you have problems or comments...

PBIL Back to PBIL home page