(data stored in ACNUC9435 zone)

EMBL: CP002400.PE533

CP002400.PE533       Location/Qualifiers
FT   CDS             565622..566494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0546"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bmd:BMD_1434 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26124"
FT                   /db_xref="GOA:E6U9D3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU26124.1"
FT                   /translation="MISLEQIQYFLAIVRYGSLNKASEHLYISQPSLSKQLQHLEKELG
FT                   CKLLIRNYDGIEATSPGKLFYEQMSGILEEFDRAIDKVRHFDEVRQLRVGGLGNLVTYF
FT                   LPRYIERLKAGGRNQVTVDTRFSNEELVKGVESGKFDLVLLSNAEPQQNLAVIPLMTEP
FT                   LYVVFPVAHPLRCQQSISFMEIVLHEKLVLYKDPCTIRASIRRQCNRMKVTPNIVLELD
FT                   LTESLLRYVSHGDGITLLPSIVAKGIQDPSIATREISRIPIYREISVAMKKENVPSYLP
FT                   MFSENIKAF"
     MISLEQIQYF LAIVRYGSLN KASEHLYISQ PSLSKQLQHL EKELGCKLLI RNYDGIEATS        60
     PGKLFYEQMS GILEEFDRAI DKVRHFDEVR QLRVGGLGNL VTYFLPRYIE RLKAGGRNQV       120
     TVDTRFSNEE LVKGVESGKF DLVLLSNAEP QQNLAVIPLM TEPLYVVFPV AHPLRCQQSI       180
     SFMEIVLHEK LVLYKDPCTI RASIRRQCNR MKVTPNIVLE LDLTESLLRY VSHGDGITLL       240
     PSIVAKGIQD PSIATREISR IPIYREISVA MKKENVPSYL PMFSENIKAF                  290
//

If you have problems or comments...

PBIL Back to PBIL home page