(data stored in ACNUC9435 zone)

EMBL: CP002400.PE536

CP002400.PE536       Location/Qualifiers
FT   CDS             574434..574934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_6414 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26127"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D6"
FT                   /inference="similar to AA sequence:KEGG:SACE_6414"
FT                   /protein_id="ADU26127.1"
FT                   /translation="MRCAWGGVTISSKGYGHSYLYLPEQKKAPHLRAKNMAVADIEPLF
FT                   VNCLKNEILNGKLIKNTADAILQACKDDGVGKANAIRPEISATGKKIENLMHTLEDGLD
FT                   NDMVRNRIIGHQAHLKILRDRPVAAQPAPTVTCEKLIEKLSRDRNLLLSDPLISGRRFG
FT                   NVL"
     MRCAWGGVTI SSKGYGHSYL YLPEQKKAPH LRAKNMAVAD IEPLFVNCLK NEILNGKLIK        60
     NTADAILQAC KDDGVGKANA IRPEISATGK KIENLMHTLE DGLDNDMVRN RIIGHQAHLK       120
     ILRDRPVAAQ PAPTVTCEKL IEKLSRDRNL LLSDPLISGR RFGNVL                      166
//

If you have problems or comments...

PBIL Back to PBIL home page