(data stored in ACNUC9435 zone)

EMBL: CP002400.PE537

CP002400.PE537       Location/Qualifiers
FT   CDS             complement(575137..578406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0551"
FT                   /product="Ig domain protein"
FT                   /note="PFAM: Ig domain protein; KEGG: tva:TVAG_495790
FT                   surface antigen BspA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26128"
FT                   /db_xref="GOA:E6U9D7"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9D7"
FT                   /inference="protein motif:PFAM:PF07523"
FT                   /protein_id="ADU26128.1"
FT                   /translation="MKMLKKRSQSLFSSRVWKQTALRAGAIAVSFAVLLSSLNLFGLNV
FT                   SADTGASADFLTYYDLNIEDGIVTGYTLKPIYNILTVPSDLSLAIPSNVTGIGDNAFDR
FT                   CNLTSVTIPSSVTSIGDYAFASCRFTSVTIPSSVTSIGAFAFVGSTLASLTVPSSVTKS
FT                   VSAFEGCDDLTSVTLAPGTTQIGDYEFNYCAGLKSVTIPDTVTSIGNLAFAGCPFANII
FT                   IPSSVNTIEGSFENCSNLKSIDLPGVTSIEGESFSGCTSLTSVGFSSHLTYIGMQAFAD
FT                   CQSLTSVIIPSSVTDVDYEAFDGSGLTSITFESATTTIGEGQSGYKDNVGVTLPASAVI
FT                   YGYDPSTAKDYAAEYGRTFKPIAEAPVTLESIAITTPPGKTSYVVGESLDITGLVVTGT
FT                   YSDGSTKVEPITSANISGFDSSAPKDSETLTVIYVGKAATYTVKIESFVSKALILGTDT
FT                   STFTNNYNDFFNTSDVSNYTISDHLFNKLVECVEDKYTNDNDYSSVVNDLLNERNSAWG
FT                   GSCFGMSSAMILSKLGNINIQNFDSYNPNVSNFSDLNKPKNDSHVRDLINYYHLSQYIP
FT                   AISDKIVNAVNPKLTGDTEQISQSVMGSIVQKAKAVASGGMPFVLQVGQISNGQPDNHA
FT                   IICNGYLKDSDGYHELEIIDPNDTTKFETLKIADDFMSYQFSDDPLTINASNWNEIGYM
FT                   DTDALRFIDIDGQDNNNPYIVSGPDTNSSAGETETLTGTYFDLGAADGFSISDASGSTF
FT                   TRAQSFAQSGSLVPDSEVPLSDGVGGEMRYHFSTAGTYTVTPEGKAMKVSALDHNSFAS
FT                   VNETGAADMVFKSNNAVDINGSSFSYTASVPDPTSDGNIQVSSNSGANVSISQNAQGVI
FT                   VSSPHLQNLTVGTVREPDGENTTQTVSTDKTSILIKDKTGDSTGAVQVFVSSKNDGNYD
FT                   QLLGTTNIPPSSTTYSLVYAAGAGGTVSGSAKQTVSQGADGTSVAAIANAGYHFVKWSD
FT                   GFISATRQDKKVTGDIRVTALFSADSSSSNSSTGTYGGISTSTPESNQMSSSNSQAAIV
FT                   NPQTGDERMNWYMVILSLILAGTAIGITAFSVLIKKKAKRR"
     MKMLKKRSQS LFSSRVWKQT ALRAGAIAVS FAVLLSSLNL FGLNVSADTG ASADFLTYYD        60
     LNIEDGIVTG YTLKPIYNIL TVPSDLSLAI PSNVTGIGDN AFDRCNLTSV TIPSSVTSIG       120
     DYAFASCRFT SVTIPSSVTS IGAFAFVGST LASLTVPSSV TKSVSAFEGC DDLTSVTLAP       180
     GTTQIGDYEF NYCAGLKSVT IPDTVTSIGN LAFAGCPFAN IIIPSSVNTI EGSFENCSNL       240
     KSIDLPGVTS IEGESFSGCT SLTSVGFSSH LTYIGMQAFA DCQSLTSVII PSSVTDVDYE       300
     AFDGSGLTSI TFESATTTIG EGQSGYKDNV GVTLPASAVI YGYDPSTAKD YAAEYGRTFK       360
     PIAEAPVTLE SIAITTPPGK TSYVVGESLD ITGLVVTGTY SDGSTKVEPI TSANISGFDS       420
     SAPKDSETLT VIYVGKAATY TVKIESFVSK ALILGTDTST FTNNYNDFFN TSDVSNYTIS       480
     DHLFNKLVEC VEDKYTNDND YSSVVNDLLN ERNSAWGGSC FGMSSAMILS KLGNINIQNF       540
     DSYNPNVSNF SDLNKPKNDS HVRDLINYYH LSQYIPAISD KIVNAVNPKL TGDTEQISQS       600
     VMGSIVQKAK AVASGGMPFV LQVGQISNGQ PDNHAIICNG YLKDSDGYHE LEIIDPNDTT       660
     KFETLKIADD FMSYQFSDDP LTINASNWNE IGYMDTDALR FIDIDGQDNN NPYIVSGPDT       720
     NSSAGETETL TGTYFDLGAA DGFSISDASG STFTRAQSFA QSGSLVPDSE VPLSDGVGGE       780
     MRYHFSTAGT YTVTPEGKAM KVSALDHNSF ASVNETGAAD MVFKSNNAVD INGSSFSYTA       840
     SVPDPTSDGN IQVSSNSGAN VSISQNAQGV IVSSPHLQNL TVGTVREPDG ENTTQTVSTD       900
     KTSILIKDKT GDSTGAVQVF VSSKNDGNYD QLLGTTNIPP SSTTYSLVYA AGAGGTVSGS       960
     AKQTVSQGAD GTSVAAIANA GYHFVKWSDG FISATRQDKK VTGDIRVTAL FSADSSSSNS      1020
     STGTYGGIST STPESNQMSS SNSQAAIVNP QTGDERMNWY MVILSLILAG TAIGITAFSV      1080
     LIKKKAKRR                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page