(data stored in ACNUC9435 zone)

EMBL: CP002400.PE54

CP002400.PE54        Location/Qualifiers
FT   CDS             62518..64056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0054"
FT                   /product="transposase IS605 OrfB"
FT                   /note="PFAM: transposase IS605 OrfB; KEGG: cce:Ccel_2298
FT                   transposase IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25645"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H8"
FT                   /inference="protein motif:PFAM:PF07282"
FT                   /protein_id="ADU25645.1"
FT                   /translation="MPCYKTLSLEIREPGRRKRELMDTALLSYTRALEQLLRQCREPVQ
FT                   ALARGGRRVTRAQVQALADKDMLRALNVYGVQPFKDSLKQDFATILLSFAARWQKSGGQ
FT                   AGYPCVRLEPEEADARIRALTDAYDAGMLSAAEMRGRLAVVLAHSGRVHPLYFGRYAAA
FT                   RDYCLLYDPGTGRFFAKLHLLNAKSRLPPAPFGRELRVVAPGLPSAQATDGPRRFIVVP
FT                   LSFGKAQQEVLRQALDHPQILRTARLVRHGDAYRLVLSVEVSCNACVVPQATMGVARAA
FT                   AALACTVCGRDGAVQGNAMLSARGGQMLFCLAKEITARALEARAQVVLEANGGRGDGFL
FT                   LRDGGRFQPEVFPAGQYMRLEHILRYKLVEAGLPPPVCVSGSGLNITCPRCGAVTRKNR
FT                   LSPQMFACVACGYAAPFPFVGSRNLAVRLQKYAGNKVPVYVREENGMRHYFNDALGFSC
FT                   TVPAEDGETVVFYELSLMAKGRQEDWCEGKKYAMLCKLRAAEDIRNAVRWVPVK"
     MPCYKTLSLE IREPGRRKRE LMDTALLSYT RALEQLLRQC REPVQALARG GRRVTRAQVQ        60
     ALADKDMLRA LNVYGVQPFK DSLKQDFATI LLSFAARWQK SGGQAGYPCV RLEPEEADAR       120
     IRALTDAYDA GMLSAAEMRG RLAVVLAHSG RVHPLYFGRY AAARDYCLLY DPGTGRFFAK       180
     LHLLNAKSRL PPAPFGRELR VVAPGLPSAQ ATDGPRRFIV VPLSFGKAQQ EVLRQALDHP       240
     QILRTARLVR HGDAYRLVLS VEVSCNACVV PQATMGVARA AAALACTVCG RDGAVQGNAM       300
     LSARGGQMLF CLAKEITARA LEARAQVVLE ANGGRGDGFL LRDGGRFQPE VFPAGQYMRL       360
     EHILRYKLVE AGLPPPVCVS GSGLNITCPR CGAVTRKNRL SPQMFACVAC GYAAPFPFVG       420
     SRNLAVRLQK YAGNKVPVYV REENGMRHYF NDALGFSCTV PAEDGETVVF YELSLMAKGR       480
     QEDWCEGKKY AMLCKLRAAE DIRNAVRWVP VK                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page