(data stored in ACNUC9435 zone)

EMBL: CP002400.PE550

CP002400.PE550       Location/Qualifiers
FT   CDS             595866..596591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0564"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="KEGG: pjd:Pjdr2_0215 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1; TIGRFAM: HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26141"
FT                   /db_xref="GOA:E6U9F0"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F0"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADU26141.1"
FT                   /translation="MKEEIKGVLFDKDGTLLDADSLWVPVGEDVADAVVQRGGMGSEGR
FT                   AVVLERIGVSGGRIIPNSPLASGTTRDVAQAACMVLRERRIPCAVDALSRELHAVIVES
FT                   VPRHAQHIRPLGDLQRLFLFLKRRGIKIGLATSDLYETAVICLTKLHVLEFFDFVGADT
FT                   GSERPKPAPDLLNRFCSTCGLRAEEVAMVGDSRVDMQMAKDGGAGLAVVIGERDMENAD
FT                   YRITTLDDLVVENERLLWA"
     MKEEIKGVLF DKDGTLLDAD SLWVPVGEDV ADAVVQRGGM GSEGRAVVLE RIGVSGGRII        60
     PNSPLASGTT RDVAQAACMV LRERRIPCAV DALSRELHAV IVESVPRHAQ HIRPLGDLQR       120
     LFLFLKRRGI KIGLATSDLY ETAVICLTKL HVLEFFDFVG ADTGSERPKP APDLLNRFCS       180
     TCGLRAEEVA MVGDSRVDMQ MAKDGGAGLA VVIGERDMEN ADYRITTLDD LVVENERLLW       240
     A                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page