(data stored in ACNUC9435 zone)

EMBL: CP002400.PE553

CP002400.PE553       Location/Qualifiers
FT   CDS             complement(598378..598635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0567"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: cpy:Cphy_1769 phosphotransferase system,
FT                   phosphocarrier protein HPr; TIGRFAM: phosphocarrier, HPr
FT                   family; PFAM: phosphoryl transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26144"
FT                   /db_xref="GOA:E6U9F3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F3"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADU26144.1"
FT                   /translation="MLSFTHTITDPAGMHARPAGLLAKCTQKCSSTVNISLNGKTADAK
FT                   RLFAVMGLGAKQNDVLSFTVTGESEAADCAAIEAFCKENL"
     MLSFTHTITD PAGMHARPAG LLAKCTQKCS STVNISLNGK TADAKRLFAV MGLGAKQNDV        60
     LSFTVTGESE AADCAAIEAF CKENL                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page