(data stored in ACNUC9435 zone)

EMBL: CP002400.PE559

CP002400.PE559       Location/Qualifiers
FT   CDS             605084..605959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0573"
FT                   /product="cobyrinic acid ac-diamide synthase"
FT                   /note="KEGG: dhd:Dhaf_1984 cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26150"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9F9"
FT                   /inference="similar to AA sequence:KEGG:Dhaf_1984"
FT                   /protein_id="ADU26150.1"
FT                   /translation="MRQLVILSGKGGTGKTTIASSFVRLAEHKVFADCDVDAPNLHQIF
FT                   GFGKVPEEKPFYGLNKAVKDDTVCTNCGKCEALCRFGAIENGKVNPYACEGCGVCEAVC
FT                   PAKDREGKAAIRLEERESGKTMLYNENGQVFSTAELFMGNGASGRLVTEVRRNLFQAAR
FT                   GEKYAILDGSPGIGCPVIASVTGVSMVLVVAEPTVSGMHDMKRIVETARRFGTKIAVCI
FT                   NKFDVSNTNTNAIKTFCGEEEIPMIGLIPYDRAVITAVNSGKAVVDYEDSMAGRAIRKI
FT                   WERAKKMLVS"
     MRQLVILSGK GGTGKTTIAS SFVRLAEHKV FADCDVDAPN LHQIFGFGKV PEEKPFYGLN        60
     KAVKDDTVCT NCGKCEALCR FGAIENGKVN PYACEGCGVC EAVCPAKDRE GKAAIRLEER       120
     ESGKTMLYNE NGQVFSTAEL FMGNGASGRL VTEVRRNLFQ AARGEKYAIL DGSPGIGCPV       180
     IASVTGVSMV LVVAEPTVSG MHDMKRIVET ARRFGTKIAV CINKFDVSNT NTNAIKTFCG       240
     EEEIPMIGLI PYDRAVITAV NSGKAVVDYE DSMAGRAIRK IWERAKKMLV S                291
//

If you have problems or comments...

PBIL Back to PBIL home page