(data stored in ACNUC9435 zone)

EMBL: CP002400.PE566

CP002400.PE566       Location/Qualifiers
FT   CDS             complement(611381..612511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0580"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   cbe:Cbei_4354 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26157"
FT                   /db_xref="GOA:E6U9G6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G6"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADU26157.1"
FT                   /translation="MEFQYYLPVNLIFGREKVNRLGETASLYGKKALIVTGRNSTKKTG
FT                   LLDRATDSLKKAGIETVLFDKVEQNPLTSTACQGAALSRASGCDVVVGIGGGSAMDSAK
FT                   AIAFLSKNEGDISDYIFGKKVSDQALPIVLVPTTCGTGSEGNGFAVLSNPENHDKKSLR
FT                   CNAIVPKASIIDPELMTTMPRHILASVGFDALCHNMEAFISRIGQPMTDILSAEGIRLL
FT                   GKYLIRAYTDPADLDAWDHISWGSTLGGMVIHTAGVTAPHGMEHPASGLHNIVHGGGLA
FT                   ALTPAVYEESISGAPEKFALISRSLGGKNETDCVDQIRHLLAQLHLSTHLGEQGIQNGD
FT                   IDWMVENCMKVSAAGIANHPVVFDREALRNIYRKAL"
     MEFQYYLPVN LIFGREKVNR LGETASLYGK KALIVTGRNS TKKTGLLDRA TDSLKKAGIE        60
     TVLFDKVEQN PLTSTACQGA ALSRASGCDV VVGIGGGSAM DSAKAIAFLS KNEGDISDYI       120
     FGKKVSDQAL PIVLVPTTCG TGSEGNGFAV LSNPENHDKK SLRCNAIVPK ASIIDPELMT       180
     TMPRHILASV GFDALCHNME AFISRIGQPM TDILSAEGIR LLGKYLIRAY TDPADLDAWD       240
     HISWGSTLGG MVIHTAGVTA PHGMEHPASG LHNIVHGGGL AALTPAVYEE SISGAPEKFA       300
     LISRSLGGKN ETDCVDQIRH LLAQLHLSTH LGEQGIQNGD IDWMVENCMK VSAAGIANHP       360
     VVFDREALRN IYRKAL                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page