(data stored in ACNUC9435 zone)

EMBL: CP002400.PE567

CP002400.PE567       Location/Qualifiers
FT   CDS             complement(612767..613318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0581"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: ere:EUBREC_0101 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; Cupin 2 conserved barrel
FT                   domain protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26158"
FT                   /db_xref="GOA:E6U9G7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9G7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU26158.1"
FT                   /translation="MDYLNENIAINLKKIRKAKKLSLDALATETGISKSMLGQIERGEA
FT                   NPTIATLGKIVSGLRVEFMDLVGPPHDEVYIMRKDTLIPIKSAKDAFRNYAYFPYEPDR
FT                   DFEIYSVEVEPGGSYPCSSHGEKTTEYNIVFSGQLTVEMGGTRYILNEGDAIRMDADKE
FT                   HCYYNAGKGILRFYMLFTWK"
     MDYLNENIAI NLKKIRKAKK LSLDALATET GISKSMLGQI ERGEANPTIA TLGKIVSGLR        60
     VEFMDLVGPP HDEVYIMRKD TLIPIKSAKD AFRNYAYFPY EPDRDFEIYS VEVEPGGSYP       120
     CSSHGEKTTE YNIVFSGQLT VEMGGTRYIL NEGDAIRMDA DKEHCYYNAG KGILRFYMLF       180
     TWK                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page