(data stored in ACNUC9435 zone)

EMBL: CP002400.PE570

CP002400.PE570       Location/Qualifiers
FT   CDS             615150..616259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0584"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; KEGG:
FT                   cbe:Cbei_4940 spermidine/putrescine ABC transporter ATPase
FT                   subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26161"
FT                   /db_xref="GOA:E6U9H0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H0"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADU26161.1"
FT                   /translation="MGKNIMVHIQDVSKSFGENRIVRNLSMDVYEGEFLTILGSSGCGK
FT                   TTTLRMVAGFEHPTSGRILVQGVDIADKEPYERDVNTVFQSYALFPHMSIFDNVAYGLK
FT                   MKKVPKKEIRERVMSMLELVQLDGFQKRMPSQLSGGQKQRVAIARALINHPKVLLLDEP
FT                   LGALDLKLRKQMQLELKRLQRKLNITFIYVTHDQEEALSMSDRIAIMHDGVLEQVAGPE
FT                   EIYEAPASKFVATFIGETNLFEGVISNMADGNVSVTIESGLIQCRGAGFHEKDIVAVSV
FT                   RPERMQFSTSSVDGFSLEGVVKEQVYVGSILKAIVVLPNGYEVKLERLAGDALPMNGAV
FT                   YLYWRPEDARLIHLQDQVVYHAVENVKLA"
     MGKNIMVHIQ DVSKSFGENR IVRNLSMDVY EGEFLTILGS SGCGKTTTLR MVAGFEHPTS        60
     GRILVQGVDI ADKEPYERDV NTVFQSYALF PHMSIFDNVA YGLKMKKVPK KEIRERVMSM       120
     LELVQLDGFQ KRMPSQLSGG QKQRVAIARA LINHPKVLLL DEPLGALDLK LRKQMQLELK       180
     RLQRKLNITF IYVTHDQEEA LSMSDRIAIM HDGVLEQVAG PEEIYEAPAS KFVATFIGET       240
     NLFEGVISNM ADGNVSVTIE SGLIQCRGAG FHEKDIVAVS VRPERMQFST SSVDGFSLEG       300
     VVKEQVYVGS ILKAIVVLPN GYEVKLERLA GDALPMNGAV YLYWRPEDAR LIHLQDQVVY       360
     HAVENVKLA                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page