(data stored in ACNUC9435 zone)

EMBL: CP002400.PE575

CP002400.PE575       Location/Qualifiers
FT   CDS             621412..622161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0589"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: bmq:BMQ_pBM70141 DNA-binding response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26166"
FT                   /db_xref="GOA:E6U9H5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU26166.1"
FT                   /translation="MSYEKRPICSGRITGIFKKGMAMQNRILIADDDREIVEVMDDALR
FT                   DEGFETVRAYNGKQVLEQLSGEKPIDLFILDIMMPEMDGLETLRHIRERTDAPVLILSA
FT                   RGREIDKVIGLRVGADDYVSKPFSVDELMARVGAHLRRENKHRQSAPVTGIGALKLDPS
FT                   SWTVEVDGKPVELSGKEFQILSYLLINAGQTVSREQIYAAVWKDAFGGDLSTVTVHIKN
FT                   LRDKLGAEGRRIRTVWGIGYRLERDLP"
     MSYEKRPICS GRITGIFKKG MAMQNRILIA DDDREIVEVM DDALRDEGFE TVRAYNGKQV        60
     LEQLSGEKPI DLFILDIMMP EMDGLETLRH IRERTDAPVL ILSARGREID KVIGLRVGAD       120
     DYVSKPFSVD ELMARVGAHL RRENKHRQSA PVTGIGALKL DPSSWTVEVD GKPVELSGKE       180
     FQILSYLLIN AGQTVSREQI YAAVWKDAFG GDLSTVTVHI KNLRDKLGAE GRRIRTVWGI       240
     GYRLERDLP                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page