(data stored in ACNUC9435 zone)

EMBL: CP002400.PE579

CP002400.PE579       Location/Qualifiers
FT   CDS             629593..630081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0596"
FT                   /product="PTS system glucitol/sorbitol-specific IIA
FT                   component"
FT                   /note="PFAM: PTS system glucitol/sorbitol-specific IIA
FT                   component; KEGG: cbe:Cbei_0339 PTS system,
FT                   glucitol/sorbitol-specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26170"
FT                   /db_xref="GOA:E6U9H9"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:E6U9H9"
FT                   /inference="protein motif:PFAM:PF03829"
FT                   /protein_id="ADU26170.1"
FT                   /translation="MCAANSCGINLRLSLLSPYYTFSKVLDYISKWREALFWQRAYMTT
FT                   IYENMVKSMGACVNSFQDEGMFILFGNQAPDTLQDYCYVIDVLPINGKIEPGQVAEIDG
FT                   TRYMITAVGELVEKKLGNFGHVTFSFTGDTQAELPGTIYLGKKPVPQLNIGSQITIHS"
     MCAANSCGIN LRLSLLSPYY TFSKVLDYIS KWREALFWQR AYMTTIYENM VKSMGACVNS        60
     FQDEGMFILF GNQAPDTLQD YCYVIDVLPI NGKIEPGQVA EIDGTRYMIT AVGELVEKKL       120
     GNFGHVTFSF TGDTQAELPG TIYLGKKPVP QLNIGSQITI HS                          162
//

If you have problems or comments...

PBIL Back to PBIL home page