(data stored in ACNUC9435 zone)

EMBL: CP002400.PE58

CP002400.PE58        Location/Qualifiers
FT   CDS             complement(67051..68019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0058"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: gct:GC56T3_2852 biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25649"
FT                   /db_xref="GOA:E6U5I2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I2"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADU25649.1"
FT                   /translation="MKKQNIHRLRIAAILLACAAMAAALGGCGIRKASTSTQTRTAKVT
FT                   RGAISVTVHGTGTIQPTSVQAVSSTVTGKVTQIFKQNGDPVNDGDNIAEVTATGTGATT
FT                   DITAPMDGVVALSQLTVGTPVQPGMTVCQVQSAASFNAVVNVDELDIAGVKAGQKADVS
FT                   VDAISGKLFSGTVQKISQVGVATNGVTDFSVTLSMDDSTGLMSNMSASADIHTGENQNA
FT                   LLVPVEALQTKGADRYLTVRTTSGKTTKDTQVKVSVGLISDTQAEITSGVNEGDTVVLP
FT                   SLAPTNGTSINGLNRNSSDSSSSSGAAASGASSTASGGKAS"
     MKKQNIHRLR IAAILLACAA MAAALGGCGI RKASTSTQTR TAKVTRGAIS VTVHGTGTIQ        60
     PTSVQAVSST VTGKVTQIFK QNGDPVNDGD NIAEVTATGT GATTDITAPM DGVVALSQLT       120
     VGTPVQPGMT VCQVQSAASF NAVVNVDELD IAGVKAGQKA DVSVDAISGK LFSGTVQKIS       180
     QVGVATNGVT DFSVTLSMDD STGLMSNMSA SADIHTGENQ NALLVPVEAL QTKGADRYLT       240
     VRTTSGKTTK DTQVKVSVGL ISDTQAEITS GVNEGDTVVL PSLAPTNGTS INGLNRNSSD       300
     SSSSSGAAAS GASSTASGGK AS                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page