(data stored in ACNUC9435 zone)

EMBL: CP002400.PE60

CP002400.PE60        Location/Qualifiers
FT   CDS             complement(68860..69834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0060"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="KEGG: ere:EUBREC_0699 putative lipid kinase; PFAM:
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25651"
FT                   /db_xref="GOA:E6U5I4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I4"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADU25651.1"
FT                   /translation="MLSERTGKNILFILNPNAGKQHIGRKSDELVTLFEESGCRVDART
FT                   TTRPGDAAELAEQLASAYDLVVCCGGDGTLHEVVNGMLRASAQVPLGYLPTGTTNDMAR
FT                   TLRLPGDVRKAAGVVLQGHTAAQDLGLFNGTQYFSYIASFGAFTSIPYSTPQWLKNLLG
FT                   YPAYLLQVLRCLPEMHPYALEMETNDGLHAKGRFLFGSVSNARSVSGIFRFKPEDVSLD
FT                   DGLFELMLIRHPENPLEFFRIAHNLIRRKADDHFVIFRHVRTVSFRFETETSWTVDGEY
FT                   GGTTRSVEIRTLHRALPFISGRPQRIRARRSRFSHSRSPHLTP"
     MLSERTGKNI LFILNPNAGK QHIGRKSDEL VTLFEESGCR VDARTTTRPG DAAELAEQLA        60
     SAYDLVVCCG GDGTLHEVVN GMLRASAQVP LGYLPTGTTN DMARTLRLPG DVRKAAGVVL       120
     QGHTAAQDLG LFNGTQYFSY IASFGAFTSI PYSTPQWLKN LLGYPAYLLQ VLRCLPEMHP       180
     YALEMETNDG LHAKGRFLFG SVSNARSVSG IFRFKPEDVS LDDGLFELML IRHPENPLEF       240
     FRIAHNLIRR KADDHFVIFR HVRTVSFRFE TETSWTVDGE YGGTTRSVEI RTLHRALPFI       300
     SGRPQRIRAR RSRFSHSRSP HLTP                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page