(data stored in ACNUC9435 zone)

EMBL: CP002400.PE62

CP002400.PE62        Location/Qualifiers
FT   CDS             72091..72858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0063"
FT                   /product="protein of unknown function DUF88"
FT                   /note="KEGG: cpi:Cpin_0806 protein of unknown function
FT                   DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25653"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5I6"
FT                   /inference="similar to AA sequence:KEGG:Cpin_0806"
FT                   /protein_id="ADU25653.1"
FT                   /translation="MEVQQDMRLAVLIDAENVPYSNVTGMLEEITRYGTPTVKRIYGDW
FT                   TTQNMSGWKNVLVPNAIVPVQQYCYTSGKNSSDSAMIIDAMDILYAGKIDGFCLVSSDS
FT                   DFTRLATRLRESGKKVYGFGEKKTPDAFIAACDKFIYLEIIASAEQDTDTTGTPGDNAP
FT                   KRREISKVDRQVIQLIANSVSDLANEDGWAFLGEVGSLILKKKPDFDSRNYGFSKLSLL
FT                   VESTKRFELDIRERGHKGHNVYIRNREKSKGGN"
     MEVQQDMRLA VLIDAENVPY SNVTGMLEEI TRYGTPTVKR IYGDWTTQNM SGWKNVLVPN        60
     AIVPVQQYCY TSGKNSSDSA MIIDAMDILY AGKIDGFCLV SSDSDFTRLA TRLRESGKKV       120
     YGFGEKKTPD AFIAACDKFI YLEIIASAEQ DTDTTGTPGD NAPKRREISK VDRQVIQLIA       180
     NSVSDLANED GWAFLGEVGS LILKKKPDFD SRNYGFSKLS LLVESTKRFE LDIRERGHKG       240
     HNVYIRNREK SKGGN                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page