(data stored in ACNUC9435 zone)

EMBL: CP002400.PE67

CP002400.PE67        Location/Qualifiers
FT   CDS             81439..82014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0068"
FT                   /product="HymD protein"
FT                   /note="KEGG: cpo:COPRO5265_0171 HymD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25658"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J1"
FT                   /inference="similar to AA sequence:KEGG:COPRO5265_0171"
FT                   /protein_id="ADU25658.1"
FT                   /translation="MPEMKKKRNSIFWVAQAGLLIALLVVVQLLTFLMPKSVPLIGQLF
FT                   TGTLVNLVLIVGAGSVGFAGTAAAAVLSPVLAFAFGQMVFPPMIPVVAIGNLVIVAVTW
FT                   AVFVHETRRPPKNSSVFRMAGIVCGAAAKTAFLWLATVLLVVPVLFGGKPAVAQVLSLM
FT                   FSWPQLVTAMVGGALALVVLRFIQGYQE"
     MPEMKKKRNS IFWVAQAGLL IALLVVVQLL TFLMPKSVPL IGQLFTGTLV NLVLIVGAGS        60
     VGFAGTAAAA VLSPVLAFAF GQMVFPPMIP VVAIGNLVIV AVTWAVFVHE TRRPPKNSSV       120
     FRMAGIVCGA AAKTAFLWLA TVLLVVPVLF GGKPAVAQVL SLMFSWPQLV TAMVGGALAL       180
     VVLRFIQGYQ E                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page