(data stored in ACNUC9435 zone)

EMBL: CP002400.PE7

CP002400.PE7         Location/Qualifiers
FT   CDS             7060..9600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: cno:NT01CX_0861 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25598"
FT                   /db_xref="GOA:E6U5D1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D1"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADU25598.1"
FT                   /translation="MNFDGQKLIPVEIREEMEKSFLEYSMSVIVSRALPDVRDGLKPVH
FT                   RRILYAMYEDNLLPTNAYRKSATTVGNVLGRYHPHGDASVYDALVRMAQSFSLRYPLVD
FT                   GHGNFGSIDGDGPAAYRYTEARMSRISLEMLQDIEKETVDFQPNFDDVRKEPIVIPSRF
FT                   PNILVNGSSGIAVGMATNIPPHNLGEVIDGMALLIDNPDATLEELTAHIQGPDFPTGGI
FT                   IMGRAGIREAYVKGRSRITLRAKATIEEDDNGRSRIIVTEIPYMVSKARIVEGIAELHK
FT                   EKRIEGISDLRDESDREGLRIVVELKRDANPQVVLNRLYTYSQLQETVPVIMLALVNGH
FT                   PRVLPLRDILTEYIHFQEQVVTRRTQYDLRKAEERAHILEGLKIALDFIDEVIRILRAS
FT                   KSIPEGKAALMERFELDDIQAQAIVQMRLGQLTNLEREKIEEELAALETKIANFKAILA
FT                   DEQRILQIVKEEALEVKAKFGDERRTRIENVSGEVDVEDLIPVEDVVLTLTNFGYIKRL
FT                   PAAAYHSQRRGGRGVNGLTRREEDVARELFVCSTHDFVLFFTSHGRCYRLKGYEVPEGS
FT                   RTSKGMNVANILPVAQDENITAMIKVPKFEEDCYLVMVTKKGIVKRTSLKEYDTARKAG
FT                   VIGILLEEDDELVGVLLTDGSAHILVGTRNGVAIRFVETDARPMGRAAHGVKAISLEGG
FT                   DYVVGVTVPNGAGSLLLITENGYGKRVPFEDFRVQNRGGKGLTSYNINEKTGPVAGLRV
FT                   VEESDDALFISSDGVVIRVPVAEIPVYSRYAQGVRVMRVGEETKVVTVTSAAHEEESEE
FT                   ESETSPEDAEQPETETAENSEKPDGGSTDNKPQS"
     MNFDGQKLIP VEIREEMEKS FLEYSMSVIV SRALPDVRDG LKPVHRRILY AMYEDNLLPT        60
     NAYRKSATTV GNVLGRYHPH GDASVYDALV RMAQSFSLRY PLVDGHGNFG SIDGDGPAAY       120
     RYTEARMSRI SLEMLQDIEK ETVDFQPNFD DVRKEPIVIP SRFPNILVNG SSGIAVGMAT       180
     NIPPHNLGEV IDGMALLIDN PDATLEELTA HIQGPDFPTG GIIMGRAGIR EAYVKGRSRI       240
     TLRAKATIEE DDNGRSRIIV TEIPYMVSKA RIVEGIAELH KEKRIEGISD LRDESDREGL       300
     RIVVELKRDA NPQVVLNRLY TYSQLQETVP VIMLALVNGH PRVLPLRDIL TEYIHFQEQV       360
     VTRRTQYDLR KAEERAHILE GLKIALDFID EVIRILRASK SIPEGKAALM ERFELDDIQA       420
     QAIVQMRLGQ LTNLEREKIE EELAALETKI ANFKAILADE QRILQIVKEE ALEVKAKFGD       480
     ERRTRIENVS GEVDVEDLIP VEDVVLTLTN FGYIKRLPAA AYHSQRRGGR GVNGLTRREE       540
     DVARELFVCS THDFVLFFTS HGRCYRLKGY EVPEGSRTSK GMNVANILPV AQDENITAMI       600
     KVPKFEEDCY LVMVTKKGIV KRTSLKEYDT ARKAGVIGIL LEEDDELVGV LLTDGSAHIL       660
     VGTRNGVAIR FVETDARPMG RAAHGVKAIS LEGGDYVVGV TVPNGAGSLL LITENGYGKR       720
     VPFEDFRVQN RGGKGLTSYN INEKTGPVAG LRVVEESDDA LFISSDGVVI RVPVAEIPVY       780
     SRYAQGVRVM RVGEETKVVT VTSAAHEEES EEESETSPED AEQPETETAE NSEKPDGGST       840
     DNKPQS                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page