(data stored in ACNUC9435 zone)

EMBL: CP002400.PE74

CP002400.PE74        Location/Qualifiers
FT   CDS             85554..87506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0075"
FT                   /product="Transposase-like Mu"
FT                   /note="PFAM: Transposase-like Mu ; Integrase catalytic
FT                   region; KEGG: dae:Dtox_4214 transposase-like Mu"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25665"
FT                   /db_xref="GOA:E6U5J8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5J8"
FT                   /inference="protein motif:PFAM:PF09299"
FT                   /protein_id="ADU25665.1"
FT                   /translation="MLTVAQVAQVKGCTERYVRTMIAKGKLEHVLDDDPRNHMRQYLVP
FT                   VAALPEKLQAKYYGRVAPTKTAAIAAPQEPPKPLDAYSEEERREIELWIGIVQEWKTYR
FT                   IGRDRKAADGAFVAQMRQRHPELSISTDVLYRRWKAWRDQHYDGLIDRRGKWRKGRYAM
FT                   DETVWECFLSYWFDLRKYPMKQCIHYTQLWCEQEHPELLAGIPSYSAFYRRWKAEIPEA
FT                   LNVLGREGDKVFDDRCGPYLPRIYDDMASNDFWIADNHTFDIISEGENGTRHRLYLTAF
FT                   MDARSGIITGFHITDNPSSEATIYALRAGILQYGIPKYIYVDNGREFLTYDVGGLGHRR
FT                   KKKSADTFSPPPIFARLGITMINAQVRNARAKIIERRFLDFKNQISRLFMTFTGGNVLE
FT                   KPANLKHVLKAGHVPADHRLREVVGQLLEGYFNEQPYNGSVAADKGKNRKDVYYDHLEE
FT                   KRVASADDLTLMLMRSTRLQKVGRMGVHLTIGGFRIDYRDDAFCLRYQGEQVYVRYDPE
FT                   NISSVRVYDEQDRFIAVLQANSNIISGYVTSKEVAKESISKIKSAKKLARQEIKSRVLA
FT                   SMDQVDALDLVLGDAQRNIAARMENGEPDRSVLQIHRVSEEPLMPPRVVNGALPLDTML
FT                   KNAENAQRASQHKDI"
     MLTVAQVAQV KGCTERYVRT MIAKGKLEHV LDDDPRNHMR QYLVPVAALP EKLQAKYYGR        60
     VAPTKTAAIA APQEPPKPLD AYSEEERREI ELWIGIVQEW KTYRIGRDRK AADGAFVAQM       120
     RQRHPELSIS TDVLYRRWKA WRDQHYDGLI DRRGKWRKGR YAMDETVWEC FLSYWFDLRK       180
     YPMKQCIHYT QLWCEQEHPE LLAGIPSYSA FYRRWKAEIP EALNVLGREG DKVFDDRCGP       240
     YLPRIYDDMA SNDFWIADNH TFDIISEGEN GTRHRLYLTA FMDARSGIIT GFHITDNPSS       300
     EATIYALRAG ILQYGIPKYI YVDNGREFLT YDVGGLGHRR KKKSADTFSP PPIFARLGIT       360
     MINAQVRNAR AKIIERRFLD FKNQISRLFM TFTGGNVLEK PANLKHVLKA GHVPADHRLR       420
     EVVGQLLEGY FNEQPYNGSV AADKGKNRKD VYYDHLEEKR VASADDLTLM LMRSTRLQKV       480
     GRMGVHLTIG GFRIDYRDDA FCLRYQGEQV YVRYDPENIS SVRVYDEQDR FIAVLQANSN       540
     IISGYVTSKE VAKESISKIK SAKKLARQEI KSRVLASMDQ VDALDLVLGD AQRNIAARME       600
     NGEPDRSVLQ IHRVSEEPLM PPRVVNGALP LDTMLKNAEN AQRASQHKDI                  650
//

If you have problems or comments...

PBIL Back to PBIL home page