(data stored in ACNUC9435 zone)

EMBL: CP002400.PE75

CP002400.PE75        Location/Qualifiers
FT   CDS             87522..88472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0076"
FT                   /product="putative ATPase, transposase-like protein"
FT                   /note="KEGG: dae:Dtox_4216 putative ATPase,
FT                   transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25666"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Y7"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4216"
FT                   /protein_id="ADU25666.1"
FT                   /translation="MAQTYDVKLQARVEELIKQCGSQAKASRILGWSDGVISQYRRSDY
FT                   ERGRVDEVEASLREYFRLQDEAAAQAQRAEPFQPVLDTYIPISVSEDIRKAIRFGQLKK
FT                   GITILHGDAGIGKTMAAEKYLRDNPNTAVLITVTPLTGTVGNVMKLICRALHIPEGRSK
FT                   LDMIIDLKERLYNTDKVLIIDEAQHLQVRALDEIRPLSEPHIDGKKGIGIVLIGNSEIY
FT                   DRMEGRRQSCFAQLYSRKRLTRKYTTKQVTPEDIALLFPALEGKKRELNFLRGICQGRY
FT                   GIRGGVNVYNNAVDAENIGIDMLTLQAREMGIGLN"
     MAQTYDVKLQ ARVEELIKQC GSQAKASRIL GWSDGVISQY RRSDYERGRV DEVEASLREY        60
     FRLQDEAAAQ AQRAEPFQPV LDTYIPISVS EDIRKAIRFG QLKKGITILH GDAGIGKTMA       120
     AEKYLRDNPN TAVLITVTPL TGTVGNVMKL ICRALHIPEG RSKLDMIIDL KERLYNTDKV       180
     LIIDEAQHLQ VRALDEIRPL SEPHIDGKKG IGIVLIGNSE IYDRMEGRRQ SCFAQLYSRK       240
     RLTRKYTTKQ VTPEDIALLF PALEGKKREL NFLRGICQGR YGIRGGVNVY NNAVDAENIG       300
     IDMLTLQARE MGIGLN                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page