(data stored in ACNUC9435 zone)

EMBL: CP002400.PE77

CP002400.PE77        Location/Qualifiers
FT   CDS             88681..89157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA2988 phosphoribosylanthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25668"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Y9"
FT                   /inference="similar to AA sequence:KEGG:MA2988"
FT                   /protein_id="ADU25668.1"
FT                   /translation="MDFVSAVKEMWNCGSTCVSLPIGNERKIVIRPRPFPKMMEKAVFG
FT                   RDKRLSEVYQGASLTLNELLANDWEVFDPAEFALAGAAPAKMDKLLELPAALSGAKKIT
FT                   SVEAAVRKLSDEELYTAADVYEERVAQGKREKTRLRFVLEEIRHRERKRGQAHA"
     MDFVSAVKEM WNCGSTCVSL PIGNERKIVI RPRPFPKMME KAVFGRDKRL SEVYQGASLT        60
     LNELLANDWE VFDPAEFALA GAAPAKMDKL LELPAALSGA KKITSVEAAV RKLSDEELYT       120
     AADVYEERVA QGKREKTRLR FVLEEIRHRE RKRGQAHA                               158
//

If you have problems or comments...

PBIL Back to PBIL home page