(data stored in ACNUC9435 zone)

EMBL: CP002400.PE78

CP002400.PE78        Location/Qualifiers
FT   CDS             89150..89458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kcr:Kcr_0525 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25669"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z0"
FT                   /inference="similar to AA sequence:KEGG:Kcr_0525"
FT                   /protein_id="ADU25669.1"
FT                   /translation="MRKTAWLLAGILLGGMAGAGGALAASDAGMTISAWAAELAVLVLV
FT                   LALGILLGYEFGRHKAYARGYRRGFEAGKNAPPDHPSCRHSFALYCEERPGRISNWN"
     MRKTAWLLAG ILLGGMAGAG GALAASDAGM TISAWAAELA VLVLVLALGI LLGYEFGRHK        60
     AYARGYRRGF EAGKNAPPDH PSCRHSFALY CEERPGRISN WN                          102
//

If you have problems or comments...

PBIL Back to PBIL home page