(data stored in ACNUC9435 zone)

EMBL: CP002400.PE83

CP002400.PE83        Location/Qualifiers
FT   CDS             91454..91777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0084"
FT                   /product="Mor transcription activator domain protein"
FT                   /note="PFAM: Mor transcription activator domain protein;
FT                   KEGG: amt:Amet_4373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25674"
FT                   /db_xref="GOA:E6U5Z5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z5"
FT                   /inference="protein motif:PFAM:PF08765"
FT                   /protein_id="ADU25674.1"
FT                   /translation="MNLERVTLEDLDGDQRELAELIGMEAYRALATHHGGTYVYVQAPN
FT                   SLLRKDRNEQIRRKFDGKNYKELALEYQISESTVRLIVEDDARRMRYGPISGQINLFDK
FT                   KMF"
     MNLERVTLED LDGDQRELAE LIGMEAYRAL ATHHGGTYVY VQAPNSLLRK DRNEQIRRKF        60
     DGKNYKELAL EYQISESTVR LIVEDDARRM RYGPISGQIN LFDKKMF                     107
//

If you have problems or comments...

PBIL Back to PBIL home page