(data stored in SCRATCH zone)

EMBL: CP002417.PE102

CP002417.PE102       Location/Qualifiers
FT   CDS             complement(103204..104754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0103"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: vap:Vapar_0090
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34325"
FT                   /db_xref="GOA:E6UYZ6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ6"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADU34325.1"
FT                   /translation="MTDLLSNHVAGRWQSGSGAGTPLFDPVLGTELARVDATGLDLPEA
FT                   FSFAREQGGNALRALTYRQRAGLLGAIVKVLQANRDAYYEIAIANSGTVKNDSAVDIDG
FT                   AIFTLGQYAKWGDALGDVRALCDGDAVKLGKEPVFQSQHLQVPTHGVALFINAFNFPSW
FT                   GLWEKAAPALLSGVPVIVKPATATAWLTQRMVRDVVDAGVLPAGALSVICGSSAGLMDQ
FT                   LQPFDVVSFTGSAETAAVIRSHPAVAARSVRANIEADSLNSALLLPGATPGSDAFNLLV
FT                   REVVREMTVKSGQKCTAIRRILVPAEVYDAAAEAIGAKLAGVTVGNPRNESVRMGSLVS
FT                   RAQLNAVRDGLDALAAQTTVLHDSRSKPLIDADPAIAACIGPVLLGARDADAAQRVHDV
FT                   EVFGPVATLLPYRDLAHGIALAHRGQGSLVTSLYGSDDAALAQAALAVAPSHGRVHVIT
FT                   PEVAQAHTGHGNVMPMSMHGGPGRAGGGAELGGLRALDFYHRKSAVQASPGVLAALGL"
     MTDLLSNHVA GRWQSGSGAG TPLFDPVLGT ELARVDATGL DLPEAFSFAR EQGGNALRAL        60
     TYRQRAGLLG AIVKVLQANR DAYYEIAIAN SGTVKNDSAV DIDGAIFTLG QYAKWGDALG       120
     DVRALCDGDA VKLGKEPVFQ SQHLQVPTHG VALFINAFNF PSWGLWEKAA PALLSGVPVI       180
     VKPATATAWL TQRMVRDVVD AGVLPAGALS VICGSSAGLM DQLQPFDVVS FTGSAETAAV       240
     IRSHPAVAAR SVRANIEADS LNSALLLPGA TPGSDAFNLL VREVVREMTV KSGQKCTAIR       300
     RILVPAEVYD AAAEAIGAKL AGVTVGNPRN ESVRMGSLVS RAQLNAVRDG LDALAAQTTV       360
     LHDSRSKPLI DADPAIAACI GPVLLGARDA DAAQRVHDVE VFGPVATLLP YRDLAHGIAL       420
     AHRGQGSLVT SLYGSDDAAL AQAALAVAPS HGRVHVITPE VAQAHTGHGN VMPMSMHGGP       480
     GRAGGGAELG GLRALDFYHR KSAVQASPGV LAALGL                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page