(data stored in SCRATCH zone)

EMBL: CP002417.PE104

CP002417.PE104       Location/Qualifiers
FT   CDS             105421..106359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0105"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; helix-turn-helix domain
FT                   protein; KEGG: vap:Vapar_0092 anaerobic benzoate catabolism
FT                   transcriptional regulator; SMART: helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34327"
FT                   /db_xref="GOA:E6UYZ8"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ8"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADU34327.1"
FT                   /translation="MNEHVDAVLATAPESGTNAAPAGEAKNPLLAALGDRVRNLRAQRG
FT                   LTRKAVAVAADVSERHLANLEYGIGNASILVLQQVAGALHCSLAELVGDITTSSPEWLL
FT                   IRELLENRSEADLRRVRVALGELLGTASVDSARHRRIALVGLRGAGKSTLGQMLADDLD
FT                   VPFVELSREIEKLAGCSVREIHDLYGTNAYRRYERRALEEAIQIYGEVVIATPGGIVSD
FT                   PATFNELLAHCTTVWLQAAPEEHMGRVAAQGDMRPMAASKEAMDDLRRILDGRAAFYSK
FT                   ADLRVDTGGKTVQQAFEALRTAVGTVVREAA"
     MNEHVDAVLA TAPESGTNAA PAGEAKNPLL AALGDRVRNL RAQRGLTRKA VAVAADVSER        60
     HLANLEYGIG NASILVLQQV AGALHCSLAE LVGDITTSSP EWLLIRELLE NRSEADLRRV       120
     RVALGELLGT ASVDSARHRR IALVGLRGAG KSTLGQMLAD DLDVPFVELS REIEKLAGCS       180
     VREIHDLYGT NAYRRYERRA LEEAIQIYGE VVIATPGGIV SDPATFNELL AHCTTVWLQA       240
     APEEHMGRVA AQGDMRPMAA SKEAMDDLRR ILDGRAAFYS KADLRVDTGG KTVQQAFEAL       300
     RTAVGTVVRE AA                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page