(data stored in ACNUC1104 zone)

EMBL: CP002417.PE105

CP002417.PE105       Location/Qualifiers
FT   CDS             complement(106391..108859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0106"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="KEGG: ctt:CtCNB1_1959 TonB-dependent siderophore
FT                   receptor; TIGRFAM: TonB-dependent siderophore receptor;
FT                   PFAM: TonB-dependent receptor; TonB-dependent receptor
FT                   plug"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34328"
FT                   /db_xref="GOA:E6UYZ9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E6UYZ9"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ADU34328.1"
FT                   /translation="MHAQPHHPAAPFPRNRLRLALRLACAMALSTAGPLALAQAANPAP
FT                   ARGANAVYDIPASPLAAALNQFAQQAGVAIALDAGKLRDLRSPGLKGRYGVEDGFAALL
FT                   AGSGQALGRTSAGYLLVPAAETAPPAAAPARPRQETTANQTLGEVTVTANQLGEITEGT
FT                   RSYTPGAIATATRLVLSPRETPQTVSVVTRQQMDDFGMTSIDDVIRATPGVSIVTYDSE
FT                   RTEYYARGFAIQNFQYDGIPMRRDSAYSAGNTLTDTSIYDRVEVLKGATGLLTGSGEPG
FT                   ATINLVRKKPTRAFQGQLSASAGSWNTYRTEADLSGALNESGSVRGRVVAALQDRHSQL
FT                   DHYKRSSKVFYGVLEADLTPSTLLTVGADYQDNDPKGSTWGGIPIFNSLGNFNSMPRSF
FT                   NNGARWSGWGQYTRTGFSTLEHQFGNGWVAKVQYNHQINGYDALLGAAAGGNPNPLDGS
FT                   GTSMWLGKYVGRTTSDALDAYASGPFKLLGREHELVVGASIARRRWKNDGYNFPGYQTN
FT                   VSGYYGWTGQVPFPVSSATPDFSDNEVTRERGLYAATRLNLSDRLKLIAGARVSSYRNK
FT                   DIDRSGEVAPYAGLIFDLTPQLSAYGSYTTIFMPQSSQDVNGRTLDPQDGKNQEVGLKG
FT                   SFLDGKLNASLAYFHLEQNNYPEATGGLTPRGGQAYRAIQGVVAKGVEAEVSGELAPGW
FT                   QLHAGFTHKVAKQDRKKVSTLEPEDQFSLYTTYRLRGALQGWTLGGGARWQSKSWGDAS
FT                   NPVLGTTTFTTDAYWLFDLMARYEFSPRLSATLRVNNALDKKYMTVFSWYSTYTWGEPR
FT                   SVNVNLVYKF"
     MHAQPHHPAA PFPRNRLRLA LRLACAMALS TAGPLALAQA ANPAPARGAN AVYDIPASPL        60
     AAALNQFAQQ AGVAIALDAG KLRDLRSPGL KGRYGVEDGF AALLAGSGQA LGRTSAGYLL       120
     VPAAETAPPA AAPARPRQET TANQTLGEVT VTANQLGEIT EGTRSYTPGA IATATRLVLS       180
     PRETPQTVSV VTRQQMDDFG MTSIDDVIRA TPGVSIVTYD SERTEYYARG FAIQNFQYDG       240
     IPMRRDSAYS AGNTLTDTSI YDRVEVLKGA TGLLTGSGEP GATINLVRKK PTRAFQGQLS       300
     ASAGSWNTYR TEADLSGALN ESGSVRGRVV AALQDRHSQL DHYKRSSKVF YGVLEADLTP       360
     STLLTVGADY QDNDPKGSTW GGIPIFNSLG NFNSMPRSFN NGARWSGWGQ YTRTGFSTLE       420
     HQFGNGWVAK VQYNHQINGY DALLGAAAGG NPNPLDGSGT SMWLGKYVGR TTSDALDAYA       480
     SGPFKLLGRE HELVVGASIA RRRWKNDGYN FPGYQTNVSG YYGWTGQVPF PVSSATPDFS       540
     DNEVTRERGL YAATRLNLSD RLKLIAGARV SSYRNKDIDR SGEVAPYAGL IFDLTPQLSA       600
     YGSYTTIFMP QSSQDVNGRT LDPQDGKNQE VGLKGSFLDG KLNASLAYFH LEQNNYPEAT       660
     GGLTPRGGQA YRAIQGVVAK GVEAEVSGEL APGWQLHAGF THKVAKQDRK KVSTLEPEDQ       720
     FSLYTTYRLR GALQGWTLGG GARWQSKSWG DASNPVLGTT TFTTDAYWLF DLMARYEFSP       780
     RLSATLRVNN ALDKKYMTVF SWYSTYTWGE PRSVNVNLVY KF                          822
//

If you have problems or comments...

PBIL Back to PBIL home page