(data stored in ACNUC1104 zone)

EMBL: CP002417.PE107

CP002417.PE107       Location/Qualifiers
FT   CDS             complement(109965..110489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0108"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: ppf:Pput_0844 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34330"
FT                   /db_xref="GOA:E6UZ01"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ01"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADU34330.1"
FT                   /translation="MSFPDTRLQPQLGDFYRAHHGWLTAWLRRKLGCAHSAADVAQDTF
FT                   VRVLASRETLRMLGSIEKPRAFLCTTAGRLLIDRARRQRIEQAYLAELALAMEGCAHPS
FT                   PKETLMAMQALAQIAAALDGLQPKPREAFLLHYLDGMTHTAIAESLGVSDRMVRKYLAL
FT                   ALLHCRVEFVQ"
     MSFPDTRLQP QLGDFYRAHH GWLTAWLRRK LGCAHSAADV AQDTFVRVLA SRETLRMLGS        60
     IEKPRAFLCT TAGRLLIDRA RRQRIEQAYL AELALAMEGC AHPSPKETLM AMQALAQIAA       120
     ALDGLQPKPR EAFLLHYLDG MTHTAIAESL GVSDRMVRKY LALALLHCRV EFVQ             174
//

If you have problems or comments...

PBIL Back to PBIL home page