(data stored in ACNUC1104 zone)

EMBL: CP002417.PE108

CP002417.PE108       Location/Qualifiers
FT   CDS             110736..112412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0109"
FT                   /product="benzoyl-CoA-dihydrodiol lyase"
FT                   /note="KEGG: vap:Vapar_0093 benzoyl-CoA-dihydrodiol lyase;
FT                   TIGRFAM: benzoyl-CoA-dihydrodiol lyase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34331"
FT                   /db_xref="GOA:E6UZ02"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017633"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ02"
FT                   /inference="protein motif:TFAM:TIGR03222"
FT                   /protein_id="ADU34331.1"
FT                   /translation="MSADTSLQPPPRVDYRTAPDQYRHWSLSFDGAIARLVLDIAEDGG
FT                   IRPGYKLKLNSYDLGVDIELNDALNRVRFEHPEVRSVIVTSGKDRIFCSGANIFMLGVS
FT                   GHAWKVNFCKFTNETRNGIEDSSKHSGLKFLAAVNGACAGGGYELALACDEILLVDDRS
FT                   SAVSLPEVPLLGVLPGTGGLTRVTDKRHVRHDLADIFCTSVEGVRGQRAVEWRLVDAVA
FT                   KPAQFAAAVQDRASQLAAGSDRPAGGKGVALTRLERTDSADGISYSHVDIQIDRSKRTA
FT                   TITVKAPTGAQPADIAAIEAAGAAWWPLAMCRELDDAILNLRTNELDVGTWLLKTEGEA
FT                   AAVLASDAVMLANKDHWLVRETIGALRRTLARLDVSSRSLFALVEAGSCFAGTLAELAF
FT                   AADRTYMLALPDDAERAPKLVLDEFNFGFFPMVNDQSRLQRRFYEEAAPLDAARAAAGK
FT                   PLDADEALKLGLVTAAPDDIDWDDEIRIAIEERAAMSPDALTGLEANLRFASKENMATR
FT                   IFGRLTAWQNWIFNRPNAVGEKGALKVYGTGEKAGFDMNRV"
     MSADTSLQPP PRVDYRTAPD QYRHWSLSFD GAIARLVLDI AEDGGIRPGY KLKLNSYDLG        60
     VDIELNDALN RVRFEHPEVR SVIVTSGKDR IFCSGANIFM LGVSGHAWKV NFCKFTNETR       120
     NGIEDSSKHS GLKFLAAVNG ACAGGGYELA LACDEILLVD DRSSAVSLPE VPLLGVLPGT       180
     GGLTRVTDKR HVRHDLADIF CTSVEGVRGQ RAVEWRLVDA VAKPAQFAAA VQDRASQLAA       240
     GSDRPAGGKG VALTRLERTD SADGISYSHV DIQIDRSKRT ATITVKAPTG AQPADIAAIE       300
     AAGAAWWPLA MCRELDDAIL NLRTNELDVG TWLLKTEGEA AAVLASDAVM LANKDHWLVR       360
     ETIGALRRTL ARLDVSSRSL FALVEAGSCF AGTLAELAFA ADRTYMLALP DDAERAPKLV       420
     LDEFNFGFFP MVNDQSRLQR RFYEEAAPLD AARAAAGKPL DADEALKLGL VTAAPDDIDW       480
     DDEIRIAIEE RAAMSPDALT GLEANLRFAS KENMATRIFG RLTAWQNWIF NRPNAVGEKG       540
     ALKVYGTGEK AGFDMNRV                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page