(data stored in ACNUC1104 zone)

EMBL: CP002417.PE111

CP002417.PE111       Location/Qualifiers
FT   CDS             115297..115740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0112"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   vap:Vapar_0096 MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34334"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ05"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADU34334.1"
FT                   /translation="MKFADFHAGQVIEAGPYVLTEEELVRFAKDYDPQWFHTDAEAAAH
FT                   SAFGGLIASGWHTCAIAMRLVVETALKGSESFASPGLEHVRWPNPVRPGDALRLVAEVI
FT                   EVRRSEKRPTLGILRWRWRLFNQRELMVLDVEVTSLFRLEAPS"
     MKFADFHAGQ VIEAGPYVLT EEELVRFAKD YDPQWFHTDA EAAAHSAFGG LIASGWHTCA        60
     IAMRLVVETA LKGSESFASP GLEHVRWPNP VRPGDALRLV AEVIEVRRSE KRPTLGILRW       120
     RWRLFNQREL MVLDVEVTSL FRLEAPS                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page