(data stored in ACNUC1104 zone)

EMBL: CP002417.PE113

CP002417.PE113       Location/Qualifiers
FT   CDS             116298..117206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0114"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: vap:Vapar_0099
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34336"
FT                   /db_xref="GOA:E6UZ07"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ07"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADU34336.1"
FT                   /translation="MRYDALVVGGSFAGLSAAMQLARARKNVCVVDAGAPRNRFAAAAH
FT                   GFFGQDGVPPLKMISDARAKLLAYPNVTLIEGRVASAQADGAGGFVASLDDGDRQLSAG
FT                   KLLLAFGVQDGFPDGIAGVRERWGTSVLHCPYCHGYEFSGRRLGVLIEAPHPPDHAMLI
FT                   AEWGPATLFLNGNNTVEEEARAKLQARGVTVEPGRIVALEGPAKDLSGVRLEDGRIVPV
FT                   DALFMVPRTRPSSPIAEQLGCAFDDGPAGPVIRTDAMKMTTVPGVYAAGDVAMPMHNAT
FT                   LSSADGVMAGTSMHRAMVFGA"
     MRYDALVVGG SFAGLSAAMQ LARARKNVCV VDAGAPRNRF AAAAHGFFGQ DGVPPLKMIS        60
     DARAKLLAYP NVTLIEGRVA SAQADGAGGF VASLDDGDRQ LSAGKLLLAF GVQDGFPDGI       120
     AGVRERWGTS VLHCPYCHGY EFSGRRLGVL IEAPHPPDHA MLIAEWGPAT LFLNGNNTVE       180
     EEARAKLQAR GVTVEPGRIV ALEGPAKDLS GVRLEDGRIV PVDALFMVPR TRPSSPIAEQ       240
     LGCAFDDGPA GPVIRTDAMK MTTVPGVYAA GDVAMPMHNA TLSSADGVMA GTSMHRAMVF       300
     GA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page