(data stored in SCRATCH zone)

EMBL: CP002417.PE114

CP002417.PE114       Location/Qualifiers
FT   CDS             complement(117401..118723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0115"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="TIGRFAM: fumarylacetoacetase; KEGG: vap:Vapar_0100
FT                   fumarylacetoacetase; PFAM: Domain of unknown function
FT                   DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34337"
FT                   /db_xref="GOA:E6UZ08"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ08"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ADU34337.1"
FT                   /translation="MIELNHTHDVDARSWVDAANVAGSDFPIQNLPYAVFRRIGSPEPF
FT                   RGGVAIGDQVLDLAALAAGSHADGLALDAARVAALPALNDFFALGPAAWQALRHLVFAL
FT                   LRSDAPAATVDDLRKCLVPQSEVEYTVPARIGDYTDFYTSIDHALNITRLFNPEGDVTP
FT                   NFRWIPTAYHGRVSTIGVSGQRFHRPMGQTLAPGAKAPTYHACARLDYELELGVWIGEG
FT                   NAAGEPIPLERAEEHIFGICLLNDWSARDIQFWEMAPLGPFLAKNFATTISPWIVTMEA
FT                   LAPYRQAWTRPSSEPQPLDYLESKSNRESGAIDIRLEVWLESEKAREGKSGPSRLSRTS
FT                   FKHQYWSVAQMVAHHTMGGCQLNPGDLFGSGTISGPGEGEAGAIIELTRAGQSPVALAN
FT                   GEQRGFLEDGDAVLLRGWCEKPGHARIGFGESRGTVLPAKG"
     MIELNHTHDV DARSWVDAAN VAGSDFPIQN LPYAVFRRIG SPEPFRGGVA IGDQVLDLAA        60
     LAAGSHADGL ALDAARVAAL PALNDFFALG PAAWQALRHL VFALLRSDAP AATVDDLRKC       120
     LVPQSEVEYT VPARIGDYTD FYTSIDHALN ITRLFNPEGD VTPNFRWIPT AYHGRVSTIG       180
     VSGQRFHRPM GQTLAPGAKA PTYHACARLD YELELGVWIG EGNAAGEPIP LERAEEHIFG       240
     ICLLNDWSAR DIQFWEMAPL GPFLAKNFAT TISPWIVTME ALAPYRQAWT RPSSEPQPLD       300
     YLESKSNRES GAIDIRLEVW LESEKAREGK SGPSRLSRTS FKHQYWSVAQ MVAHHTMGGC       360
     QLNPGDLFGS GTISGPGEGE AGAIIELTRA GQSPVALANG EQRGFLEDGD AVLLRGWCEK       420
     PGHARIGFGE SRGTVLPAKG                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page