(data stored in SCRATCH zone)

EMBL: CP002417.PE115

CP002417.PE115       Location/Qualifiers
FT   CDS             complement(118743..119549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0116"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: vap:Vapar_0101
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34338"
FT                   /db_xref="GOA:E6UZ09"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ09"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ADU34338.1"
FT                   /translation="MPRKFVDLSIFLENDVLSDPPAFAPKIQYFTHEQTYEQIEPFFPG
FT                   LKKEDLPDGEGWAVELVQLSTHNGTHLDAPYHFHSTMDKALGEKKPAIAIHDVPLEWCF
FT                   QPGVKLDFRHFADGYVVTAADVEAELKRIGHTLSPLEIVVVNTRAGKRYGSNDYVSAGA
FT                   GMGYEATMYLLERGVRLTGTDAWSWDAPFVHTAKKYGETQDASLIWEGHKAGRDIGYCH
FT                   IEKLHNLEVLPPTGFFISCFPHKIRGASAGWTRAVAIFDDALMASV"
     MPRKFVDLSI FLENDVLSDP PAFAPKIQYF THEQTYEQIE PFFPGLKKED LPDGEGWAVE        60
     LVQLSTHNGT HLDAPYHFHS TMDKALGEKK PAIAIHDVPL EWCFQPGVKL DFRHFADGYV       120
     VTAADVEAEL KRIGHTLSPL EIVVVNTRAG KRYGSNDYVS AGAGMGYEAT MYLLERGVRL       180
     TGTDAWSWDA PFVHTAKKYG ETQDASLIWE GHKAGRDIGY CHIEKLHNLE VLPPTGFFIS       240
     CFPHKIRGAS AGWTRAVAIF DDALMASV                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page