(data stored in SCRATCH zone)

EMBL: CP002417.PE116

CP002417.PE116       Location/Qualifiers
FT   CDS             complement(119618..120409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0117"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0102
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34339"
FT                   /db_xref="GOA:E6UZ10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ10"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34339.1"
FT                   /translation="MNSNDRAPSSLNWLGSFAVLCALIALWWVASNAGWVSRVFLPTPQ
FT                   ATFASLLEGLNLSGGSGNGELLAFTQATVGRMVEGWLLASLFGVVLGAAIGVSPAVRAW
FT                   IQPTLEFIRPLPASALLPLAISIFGLNPGMVLFVVAFGAMWPVLLATVHGFAAVEPRLA
FT                   EVARCLQMSRAAYIWKMGLPNAMPDILAGMRLALTIALIVAVVGEMIASQSGLGQAILL
FT                   AARAFRASDLFAGIVLLGLIGFVSNALLAFAEKRLLRWQQP"
     MNSNDRAPSS LNWLGSFAVL CALIALWWVA SNAGWVSRVF LPTPQATFAS LLEGLNLSGG        60
     SGNGELLAFT QATVGRMVEG WLLASLFGVV LGAAIGVSPA VRAWIQPTLE FIRPLPASAL       120
     LPLAISIFGL NPGMVLFVVA FGAMWPVLLA TVHGFAAVEP RLAEVARCLQ MSRAAYIWKM       180
     GLPNAMPDIL AGMRLALTIA LIVAVVGEMI ASQSGLGQAI LLAARAFRAS DLFAGIVLLG       240
     LIGFVSNALL AFAEKRLLRW QQP                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page