(data stored in ACNUC1104 zone)

EMBL: CP002417.PE117

CP002417.PE117       Location/Qualifiers
FT   CDS             complement(120406..121176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0118"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0103
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34340"
FT                   /db_xref="GOA:E6UZ11"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ11"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34340.1"
FT                   /translation="MTEGRLFRWLRPWVFPALLVGAFEWYARRAAALGSDALAPPSAAA
FT                   KAFAGAALDGSLWQATGFTLGTAALGLLIGAVLGIALGLVLGLSRRAAQLGSVSIEVLR
FT                   PVPSVALIPLAMLAFGFGVRMELAIVAFATFWPLLVLVQSAVQQIEPRLLEVSRVLGLS
FT                   ARERAFKIVLPAIVPRLFVALRLGVAVALVVAVTVEIAANPNGMGYAMMIAQQSFDPAL
FT                   MLAWLGWIGVVGFAVNAGMVLLQRTVARRMGVMA"
     MTEGRLFRWL RPWVFPALLV GAFEWYARRA AALGSDALAP PSAAAKAFAG AALDGSLWQA        60
     TGFTLGTAAL GLLIGAVLGI ALGLVLGLSR RAAQLGSVSI EVLRPVPSVA LIPLAMLAFG       120
     FGVRMELAIV AFATFWPLLV LVQSAVQQIE PRLLEVSRVL GLSARERAFK IVLPAIVPRL       180
     FVALRLGVAV ALVVAVTVEI AANPNGMGYA MMIAQQSFDP ALMLAWLGWI GVVGFAVNAG       240
     MVLLQRTVAR RMGVMA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page