(data stored in SCRATCH zone)

EMBL: CP002417.PE12

CP002417.PE12        Location/Qualifiers
FT   CDS             complement(12168..13439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0012"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0012 cardiolipin synthase 2; PFAM:
FT                   phospholipase D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34235"
FT                   /db_xref="GOA:E6UXP1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXP1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34235.1"
FT                   /translation="MSHGNHWVGGNRIELLENGEEFFPRVFDAIRAAEREVIVETFILF
FT                   EDKVGLGLHAALREAAQRGAKVDLMIDGFGSPDLSREFIEGLTSVGVKVRVFDPGHRFM
FT                   GQRLNVFRRMHRKIVVVDGERAFVGGINYSADHLLDFGPKAKQDWAVELAGPIVAEIHQ
FT                   FVLRAIAVGGKGAGWFRRRLKQAPPVRQLTAGEADAMFVTRDNRRHTNDIERHYRAAIR
FT                   AARERIVIANAYFFPGYRLIKELRRAARRGVDVRLILQGEPDMPIVKTAASMLYHHLLH
FT                   AGVRIYEYCDRPLHGKVALMDDRWSTVGSSNLDPLSLSLNLEANVVVRDKAFNEVLWKR
FT                   MDQLMQESCKRIETTDLASEWSGWRLVRSFFIFHFLRWYPAWLDRLPRHVPRLTPAEAT
FT                   DLAERQKNEKNSNNTGGATPTEAA"
     MSHGNHWVGG NRIELLENGE EFFPRVFDAI RAAEREVIVE TFILFEDKVG LGLHAALREA        60
     AQRGAKVDLM IDGFGSPDLS REFIEGLTSV GVKVRVFDPG HRFMGQRLNV FRRMHRKIVV       120
     VDGERAFVGG INYSADHLLD FGPKAKQDWA VELAGPIVAE IHQFVLRAIA VGGKGAGWFR       180
     RRLKQAPPVR QLTAGEADAM FVTRDNRRHT NDIERHYRAA IRAARERIVI ANAYFFPGYR       240
     LIKELRRAAR RGVDVRLILQ GEPDMPIVKT AASMLYHHLL HAGVRIYEYC DRPLHGKVAL       300
     MDDRWSTVGS SNLDPLSLSL NLEANVVVRD KAFNEVLWKR MDQLMQESCK RIETTDLASE       360
     WSGWRLVRSF FIFHFLRWYP AWLDRLPRHV PRLTPAEATD LAERQKNEKN SNNTGGATPT       420
     EAA                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page