(data stored in ACNUC1104 zone)

EMBL: CP002417.PE120

CP002417.PE120       Location/Qualifiers
FT   CDS             complement(122967..123701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0121"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vap:Vapar_0106
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34343"
FT                   /db_xref="GOA:E6UZ14"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ14"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU34343.1"
FT                   /translation="MNTRTPTARRSAPRAAAITAEAGRPDRRQAILLAAEKLFAQHGYH
FT                   AVTIRQIAEEAGVPLALVGYYFGPKHELFHAIFEHWSHTIEERLTRLAEVNNDPDDACT
FT                   LPSIIEAFTTPVLALRASAEGEYYALLVARELYHATEEADRVLRGYFDPLAAAYIDALH
FT                   VALPHATRGQVAWGYQFALGALLHHLNDSRIERLSRGENKRADPAVAPMLVNFIVGGLR
FT                   AALPKPKTPRTQQKTPTRRQKT"
     MNTRTPTARR SAPRAAAITA EAGRPDRRQA ILLAAEKLFA QHGYHAVTIR QIAEEAGVPL        60
     ALVGYYFGPK HELFHAIFEH WSHTIEERLT RLAEVNNDPD DACTLPSIIE AFTTPVLALR       120
     ASAEGEYYAL LVARELYHAT EEADRVLRGY FDPLAAAYID ALHVALPHAT RGQVAWGYQF       180
     ALGALLHHLN DSRIERLSRG ENKRADPAVA PMLVNFIVGG LRAALPKPKT PRTQQKTPTR       240
     RQKT                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page