(data stored in ACNUC1104 zone)

EMBL: CP002417.PE122

CP002417.PE122       Location/Qualifiers
FT   CDS             125805..126260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34345"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:E6UZ16"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0121"
FT                   /protein_id="ADU34345.1"
FT                   /translation="MSRMKRRTSLLMLSAAAGASMLSACASSTPASKPAGAASLRVSGT
FT                   VAYRERIALDPAAEVVVQLLDVSRMDAPSVTLAEQRIKANGKQVPFAYELQVDAARIDP
FT                   RMRYAVSARILRGEQLLFINDTQYPVLTQGSGTTANLVLVRVTPSPR"
     MSRMKRRTSL LMLSAAAGAS MLSACASSTP ASKPAGAASL RVSGTVAYRE RIALDPAAEV        60
     VVQLLDVSRM DAPSVTLAEQ RIKANGKQVP FAYELQVDAA RIDPRMRYAV SARILRGEQL       120
     LFINDTQYPV LTQGSGTTAN LVLVRVTPSP R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page